PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.010G015500.1
Common NameB456_010G015500, LOC105774755
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 276aa    MW: 30580.5 Da    PI: 9.4506
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.010G015500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.55.5e-32110163255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         pr+rWt++LH++Fv+av+ LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Gorai.010G015500.1 110 PRMRWTTTLHAHFVHAVQLLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRT 163
                         9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.18E-15107164IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.7E-28108164IPR009057Homeodomain-like
TIGRFAMsTIGR015571.6E-23110163IPR006447Myb domain, plants
PfamPF002491.6E-7111162IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0080060Biological Processintegument development
GO:0005618Cellular Componentcell wall
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MMRTTALPDL SLQISPPSVK EMADDGLSMK SIYSDRSSTA DSGSSGSDLS QENGCFNNPI  60
EPTLSLGFEM VHHHHHQHHH HQYQPQIYGR NFKRSSRTNI NGAKRSIRAP RMRWTTTLHA  120
HFVHAVQLLG GHERATPKSV LELMNVKDLT LAHVKSHLQM YRTVKSTDKG SGQMQADMKL  180
NQRSGIVDLD GRLISPQPTP QRTQSGSWLP SMEVKNLSIS SNGNGLTLHP NDAKVDGDNK  240
VLHLSNPDML LNLEFTLGRP SFAHESSNDL TLLKC*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00107PBMTransfer from AT5G42630Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP2719891e-79KP271989.1 UNVERIFIED: Populus trichocarpa isolate Potri.014G037200_BESC-125 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012452786.10.0PREDICTED: probable transcription factor KAN4
SwissprotQ9FJV53e-71KAN4_ARATH; Probable transcription factor KAN4
TrEMBLA0A0D2SKY50.0A0A0D2SKY5_G
STRINGVIT_18s0001g11390.t013e-96(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65722844
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.15e-68G2-like family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]